Explore
Validate
Learn
Western blot
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002550 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002550, RRID:AB_1080419
- Product name
- Anti-TTR
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAAD
DTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEI
DTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA
ALLSPYSYSTTAVVTNPKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Ophthalmic manifestations in a Chinese family with familial amyloid polyneuropathy due to a TTR Gly83Arg mutation.
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Heparan sulfate/heparin promotes transthyretin fibrillization through selective binding to a basic motif in the protein
Liu T, Zhang B, Jin X, Wang W, Lee J, Li J, Yuan H, Cheng X
Eye (London, England) 2014 Jan;28(1):26-33
Eye (London, England) 2014 Jan;28(1):26-33
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM
Proteome science 2011 Nov 17;9:73
Proteome science 2011 Nov 17;9:73
Heparan sulfate/heparin promotes transthyretin fibrillization through selective binding to a basic motif in the protein
Noborn F, O'Callaghan P, Hermansson E, Zhang X, Ancsin J, Damas A, Dacklin I, Presto J, Johansson J, Saraiva M, Lundgren E, Kisilevsky R, Westermark P, Li J
Proceedings of the National Academy of Sciences 2011 April;108(14):5584-5589
Proceedings of the National Academy of Sciences 2011 April;108(14):5584-5589
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human pancreas and tonsil tissues using HPA002550 antibody. Corresponding TTR RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in a subset of islets of Langerhans cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows positivity in plasma.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity as expected.
- Sample type
- HUMAN
