Explore
Validate
LearnHPA002807
antibody from Atlas Antibodies
Targeting: MFGE8
BA46, EDIL1, hP47, HsT19888, MFG-E8, OAcGD3S, SED1, SPAG10
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002807 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002807, RRID:AB_1078072
- Product name
- Anti-MFGE8
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLD
KQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQ
GARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGS
SKIFPGNWDNHSHKKNLFETPILARYVRILPVAWH
NRIALRLEL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Cell surface and secreted protein profiles of human thyroid cancer cell lines reveal distinct glycoprotein patterns.
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Cell surface and secreted protein profiles of human thyroid cancer cell lines reveal distinct glycoprotein patterns.
Arcinas A, Yen TY, Kebebew E, Macher BA
Journal of proteome research 2009 Aug;8(8):3958-68
Journal of proteome research 2009 Aug;8(8):3958-68
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-MFGE8 antibody. Corresponding MFGE8 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human heart muscle and liver tissues using HPA002807 antibody. Corresponding MFGE8 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in aortic media.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows moderate to strong cytoplasmic positivity in intercalated discs.
- Sample type
- HUMAN
