Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503933 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-MAP/microtubule Affinity-Regulating Kinase 3 (MARK3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLT
SKLTR SRNVSAEQKD- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Conformational instability of the MARK3 UBA domain compromises ubiquitin recognition and promotes interaction with the adjacent kinase domain.
Murphy JM, Korzhnev DM, Ceccarelli DF, Briant DJ, Zarrine-Afsar A, Sicheri F, Kay LE, Pawson T
Proceedings of the National Academy of Sciences of the United States of America 2007 Sep 4;104(36):14336-41
Proceedings of the National Academy of Sciences of the United States of America 2007 Sep 4;104(36):14336-41
No comments: Submit comment
No validations: Submit validation data