Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502752 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-FXYD Domain Containing Ion Transport Regulator 1 (FXYD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FXYD1 antibody: synthetic peptide directed towards the N terminal of human FXYD1
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSL
QIGGL VIAGILFILG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Purification of the human alpha2 Isoform of Na,K-ATPase expressed in Pichia pastoris. Stabilization by lipids and FXYD1.
Lifshitz Y, Petrovich E, Haviv H, Goldshleger R, Tal DM, Garty H, Karlish SJ
Biochemistry 2007 Dec 25;46(51):14937-50
Biochemistry 2007 Dec 25;46(51):14937-50
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting