Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001393 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001393, RRID:AB_1078892
- Product name
- Anti-FLOT1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVN
MGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDA
RIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAK
AQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTK
QQIEEQR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Expression of flotillins in the human placenta: potential implications for placental transcytosis.
Walton JR, Frey HA, Vandre DD, Kwiek JJ, Ishikawa T, Takizawa T, Robinson JM, Ackerman WE 4th
Histochemistry and cell biology 2013 Mar;139(3):487-500
Histochemistry and cell biology 2013 Mar;139(3):487-500
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human adrenal gland and skin tissues using Anti-FLOT1 antibody. Corresponding FLOT1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows distinct cytoplasmic and membranous positivity with a granular pattern.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN