PAB28425

SNTB2 antibody from Abnova Corporation
D16S2531E, EST25263, SNT2B2, SNT3, SNTL

Antibody data

Product number
PAB28425
Provider
Abnova Corporation
Product name
SNTB2 polyclonal antibody
Provider product page
Abnova Corporation - PAB28425
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to human SNTB2.
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
NRMPILISKIFPGLAADQSRALRLGDAILSVNGTD
LRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIK
KPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNST
KDRKIIPLKMCFAARNLSMPDLENRL
Isotype
IgG
Vial size
100 μl
Storage
Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -