H00006645-B01

SNTB2 antibody from Abnova Corporation
D16S2531E, EST25263, SNT2B2, SNT3, SNTL

Antibody data

Product number
H00006645-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006645-B01, RRID:AB_1115731
Product name
SNTB2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006645-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SNTB2 protein.
Antigen sequence
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRER
WVRVVAELSGESLSLTGDAAAAELEPALGPAAAAF
NGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAG
EAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPI
LISKIFPGLAADQSRALRLGDAILSVNGTDLRQAT
HDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLV
SDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKI
IPLKMCFAARNLSMPDLENRQN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -