Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000467-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000467-M04, RRID:AB_534783
- Product name
- ATF3 monoclonal antibody (M04), clone 8G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ATF3.
- Antigen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFA
NLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRN
KKKEKTECLQKESEKLESVNAELKAQIEELKNEKQ
HLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIK
EGTLQS- Isotype
- IgG
- Antibody clone number
- 8G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Transcriptional regulators of the ΔNp63: their role in limbal epithelial cell proliferation.
Hsueh YJ, Kuo PC, Chen JK
Journal of cellular physiology 2013 Mar;228(3):536-46
Journal of cellular physiology 2013 Mar;228(3):536-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ATF3 monoclonal antibody (M04), clone 8G5 Western Blot analysis of ATF3 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ATF3 expression in transfected 293T cell line by ATF3 monoclonal antibody (M04), clone 8G5.Lane 1: ATF3 transfected lysate(20.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ATF3 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol