Explore
Validate
Learn
Immunocytochemistry
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001562 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001562, RRID:AB_1078233
- Product name
- Anti-ATF3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFA
NLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRN
KKKEKTEC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The activating transcription factor 3 protein suppresses the oncogenic function of mutant p53 proteins.
Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib.
Opposing roles for calcineurin and ATF3 in squamous skin cancer
Wei S, Wang H, Lu C, Malmut S, Zhang J, Ren S, Yu G, Wang W, Tang DD, Yan C
The Journal of biological chemistry 2014 Mar 28;289(13):8947-59
The Journal of biological chemistry 2014 Mar 28;289(13):8947-59
Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib.
Edagawa M, Kawauchi J, Hirata M, Goshima H, Inoue M, Okamoto T, Murakami A, Maehara Y, Kitajima S
The Journal of biological chemistry 2014 Aug 1;289(31):21544-61
The Journal of biological chemistry 2014 Aug 1;289(31):21544-61
Opposing roles for calcineurin and ATF3 in squamous skin cancer
Wu X, Nguyen B, Dziunycz P, Chang S, Brooks Y, Lefort K, Hofbauer G, Dotto G
Nature 2010 May;465(7296):368-372
Nature 2010 May;465(7296):368-372
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and skeletal muscle tissues using HPA001562 antibody. Corresponding ATF3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
- Sample type
- HUMAN
