Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003304-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003304-M02, RRID:AB_565860
- Product name
- HSPA1B monoclonal antibody (M02), clone 3B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HSPA1B.
- Antigen sequence
VQRERVSAKNALESYAFNMKSAVEDEGLKGKISEA
DKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLY- Isotype
- IgG
- Antibody clone number
- 3B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle.
Functional analysis of beef tenderness.
Picard B, Gagaoua M, Micol D, Cassar-Malek I, Hocquette JF, Terlouw CE
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Journal of agricultural and food chemistry 2014 Oct 8;62(40):9808-18
Functional analysis of beef tenderness.
Guillemin N, Bonnet M, Jurie C, Picard B
Journal of proteomics 2011 Dec 21;75(2):352-65
Journal of proteomics 2011 Dec 21;75(2):352-65
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSPA1B monoclonal antibody (M02), clone 3B7 Western Blot analysis of HSPA1B expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSPA1B monoclonal antibody (M02), clone 3B7. Western Blot analysis of HSPA1B expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HSPA1B is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HSPA1B on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HSPA1B on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TP53 and HSPA1B. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-HSPA1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
