HPA043355

antibody from Atlas Antibodies

Targeting: CALR3 CRT2, CT93, FLJ25355, MGC26577

Antibody data

Submit

Validation data

Product number: HPA043355 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043355, RRID:AB_2678442
Product name: Anti-CALR3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKE EMKKAREEEEEELLSGKINRHEHYFNQFHRRN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CALR3 protein structure - HPA043355 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-CALR3 antibody. Corresponding CALR3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and testis using Anti-CALR3 antibody HPA043355 (A) shows similar protein distribution across tissues to independent antibody HPA048460 (B).
Antibody #2 product nr: HPA048460
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in spermatids.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CALR3 antibody HPA043355.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CALR3 antibody HPA043355.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CALR3 antibody HPA043355.
Sample type: HUMAN