Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019585 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019585, RRID:AB_1848385
- Product name
- Anti-TVP23B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Role of FAM18B in diabetic retinopathy.
Wang AL, Rao VR, Chen JJ, Lussier YA, Rehman J, Huang Y, Jager RD, Grassi MA
Molecular vision 2014;20:1146-59
Molecular vision 2014;20:1146-59
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows strong membranous positivity in alveolar cells.
- Sample type
- HUMAN