HPA003563

antibody from Atlas Antibodies

Targeting: C3 ARMD9, C3a, C3b, CPAMD1

Antibody data

Submit

Validation data

Product number: HPA003563 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003563, RRID:AB_1847117
Product name: Anti-C3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELN LDVSLQLPSRSSKITHRIHWESASLLRSEETKENE GFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDL KVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDA TMS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

C3 protein structure - HPA003563 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adipose tissue, kidney, lung and testis using Anti-C3 antibody HPA003563 (A) shows similar protein distribution across tissues to independent antibody HPA020432 (B).
Antibody #2 product nr: HPA020432
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows distinct positivity in plasma.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong extracellular space positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong extracellular space positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong extracellular space positivity in Leydig cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adipose tissue shows strong extracellular space positivity in adipocytes.
Sample type: HUMAN