Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005689 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005689, RRID:AB_1845372
- Product name
- Anti-BLM
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELN
PETSTDCDARQISLQQQLIHVMEHICKLIDTIPDD
KLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLL
GSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLP
SNSV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion.
Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers.
Meena JK, Cerutti A, Beichler C, Morita Y, Bruhn C, Kumar M, Kraus JM, Speicher MR, Wang ZQ, Kestler HA, d'Adda di Fagagna F, Günes C, Rudolph KL
The EMBO journal 2015 May 12;34(10):1371-84
The EMBO journal 2015 May 12;34(10):1371-84
Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers.
Lao VV, Welcsh P, Luo Y, Carter KT, Dzieciatkowski S, Dintzis S, Meza J, Sarvetnick NE, Monnat RJ Jr, Loeb LA, Grady WM
Translational oncology 2013 Aug;6(4):458-69
Translational oncology 2013 Aug;6(4):458-69
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & cytoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN