SAB1401895

COL25A1 antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider

Antibody data

Product number
SAB1401895
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401895, RRID:AB_10608121
Product name
Monoclonal Anti-COL25A1 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401895
Antibody type
Monoclonal
Antigen
COL25A1 (NP_942014, 57 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
NDLQARIAALESAKGAPSIHLLPDTLDHLKTMVQE
KVERLLAQKSYEHMAKIRIAREAPSECNCPA*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -