Explore
Validate
LearnHPA002997
antibody from Atlas Antibodies
Targeting: LAMTOR1
C11orf59, FLJ20625, p18, p27RF-Rho, Pdro, Ragulator1
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002997 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002997, RRID:AB_1845531
- Product name
- Anti-LAMTOR1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSL
PSARTDEQALLSSILAKTASNIIDVSAADSQGMEQ
HEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTS
QPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRV
DAKEELVV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references mTOR activates the VPS34-UVRAG complex to regulate autolysosomal tubulation and cell survival.
MTORC1 functions as a transcriptional regulator of autophagy by preventing nuclear transport of TFEB.
The late endosomal adaptor p14 is a macrophage host-defense factor against Salmonella infection
Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts
Munson MJ, Allen GF, Toth R, Campbell DG, Lucocq JM, Ganley IG
The EMBO journal 2015 Sep 2;34(17):2272-90
The EMBO journal 2015 Sep 2;34(17):2272-90
MTORC1 functions as a transcriptional regulator of autophagy by preventing nuclear transport of TFEB.
Martina JA, Chen Y, Gucek M, Puertollano R
Autophagy 2012 Jun;8(6):903-14
Autophagy 2012 Jun;8(6):903-14
The late endosomal adaptor p14 is a macrophage host-defense factor against Salmonella infection
Taub N, Nairz M, Hilber D, Hess M, Weiss G, Huber L
Journal of Cell Science 2012 July;125(11):2698-2708
Journal of Cell Science 2012 July;125(11):2698-2708
Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts
Stasyk T, Holzmann J, Stumberger S, Ebner H, Hess M, Bonn G, Mechtler K, Huber L
PROTEOMICS 2010 November;10(22):4117-4127
PROTEOMICS 2010 November;10(22):4117-4127
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMTOR1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong granular cytoplasmic positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong strong granular cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
