Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28419 - Provider product page
- Provider
- Abnova Corporation
- Product name
- STX5 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant STX5.
- Antigen sequence
QIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKL
ASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSA
LPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTS
QQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQ
QLAHMV- Isotype
- IgG
- Storage
- Store at 4 °C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of HEK293T cell lysate using STX5 polyclonal antibody (Cat # PAB28419).Lane 1: Negative control (vector only)Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of U-2 OS cell line with STX5 polyclonal antibody (Cat # PAB28419) shows positivity in nucleus but not nucleoli and golgi apparatus. Fixation/Permeabilization: PFA/Triton X-100
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human pancreas with STX5 polyclonal antibody (Cat # PAB28419) shows strong cytoplasmic positivity in exocrine glandular cells.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)