Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183372 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Gap Junction Protein, alpha 5, 40kDa (GJA5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GJA5 antibody: synthetic peptide directed towards the N terminal of human GJA5
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGS
GSYEY PVAEKAELSC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Congenital atrial standstill associated with coinheritance of a novel SCN5A mutation and connexin 40 polymorphisms.
Makita N, Sasaki K, Groenewegen WA, Yokota T, Yokoshiki H, Murakami T, Tsutsui H
Heart rhythm : the official journal of the Heart Rhythm Society 2005 Oct;2(10):1128-34
Heart rhythm : the official journal of the Heart Rhythm Society 2005 Oct;2(10):1128-34
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting