Explore
Validate
LearnH00006348-M01
antibody from Abnova Corporation
Targeting: CCL3
G0S19-1, LD78ALPHA, MIP-1-alpha, SCYA3
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006348-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006348-M01, RRID:AB_581663
- Product name
- CCL3 monoclonal antibody (M01), clone 4E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCL3.
- Antigen sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCS
KPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA- Isotype
- IgG
- Antibody clone number
- 4E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A multiplex assay to measure RNA transcripts of prostate cancer in urine.
Quek SI, Ho ME, Loprieno MA, Ellis WJ, Elliott N, Liu AY
PloS one 2012;7(9):e45656
PloS one 2012;7(9):e45656
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CCL3 expression in transfected 293T cell line by CCL3 monoclonal antibody (M01), clone 4E7.Lane 1: CCL3 transfected lysate(10.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CCL3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
