HPA072754

antibody from Atlas Antibodies

Targeting: ABL2 ABLL, ARG

Antibody data

Submit

Validation data

Product number: HPA072754 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA072754, RRID:AB_2732212
Product name: Anti-ABL2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGA QDATENSASSLAPGFIRGAQASSGSPALPRKQRDK SPSSLLEDAKETCFTRDRKGGFFSSF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ABL2 protein structure - HPA072754 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human caudate shows moderate positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons and neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.
Sample type: HUMAN