Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183150 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-gamma-aminobutyric Acid (GABA) Receptor, theta (GABRQ) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABRQ antibody: synthetic peptide directed towards the N terminal of human GABRQ
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
KFHFEFSSAVPEVVLNLFNCKNCANEAVVQKILDR
VLSRY DVRLRPNFGG- Vial size
- 50 µg
Submitted references mRNA and protein expression for novel GABAA receptors θ and ρ2 are altered in schizophrenia and mood disorders; relevance to FMRP-mGluR5 signaling pathway.
GABA(A) receptor epsilon and theta subunits display unusual structural variation between species and are enriched in the rat locus ceruleus.
Fatemi SH, Folsom TD, Rooney RJ, Thuras PD
Translational psychiatry 2013 Jun 18;3:e271
Translational psychiatry 2013 Jun 18;3:e271
GABA(A) receptor epsilon and theta subunits display unusual structural variation between species and are enriched in the rat locus ceruleus.
Sinkkonen ST, Hanna MC, Kirkness EF, Korpi ER
The Journal of neuroscience : the official journal of the Society for Neuroscience 2000 May 15;20(10):3588-95
The Journal of neuroscience : the official journal of the Society for Neuroscience 2000 May 15;20(10):3588-95
No comments: Submit comment
No validations: Submit validation data