Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003215 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003215, RRID:AB_1078881
- Product name
- Anti-OGFOD1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EPENNQMAISNNSQQSNEQTDPEPEENETKKESSV
PMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCG
CEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLAL
VYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFS
F- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references OGFOD1 is required for breast cancer cell proliferation and is associated with poor prognosis in breast cancer.
Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy.
OGFOD1, a Novel Modulator of Eukaryotic Translation Initiation Factor 2 Phosphorylation and the Cellular Response to Stress
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Kim JH, Lee SM, Lee JH, Chun S, Kang BH, Kwak S, Roe JS, Kim TW, Kim H, Kim WH, Cho EJ, Youn HD
Oncotarget 2015 Aug 14;6(23):19528-41
Oncotarget 2015 Aug 14;6(23):19528-41
Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy.
Loenarz C, Sekirnik R, Thalhammer A, Ge W, Spivakovsky E, Mackeen MM, McDonough MA, Cockman ME, Kessler BM, Ratcliffe PJ, Wolf A, Schofield CJ
Proceedings of the National Academy of Sciences of the United States of America 2014 Mar 18;111(11):4019-24
Proceedings of the National Academy of Sciences of the United States of America 2014 Mar 18;111(11):4019-24
OGFOD1, a Novel Modulator of Eukaryotic Translation Initiation Factor 2 Phosphorylation and the Cellular Response to Stress
Wehner K, Schutz S, Sarnow P
Molecular and Cellular Biology 2010 March;30(8):2006-2016
Molecular and Cellular Biology 2010 March;30(8):2006-2016
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse midbrain shows immunoreactivity in neuronal soma and nuclei of the ventral tegmental area.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse hippocampus shows positivity in the CA3 area neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebellum shows moderate labelling of Purkinje cells.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate nuclear and cytoplasmic immunoreactivity in neuronal cell bodies.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong nuclear immunoreactivity in Purkinje cells and moderate positivity in granular cell layer.
- Sample type
- HUMAN
