Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [78]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008878-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008878-M01, RRID:AB_437085
- Product name
- SQSTM1 monoclonal antibody (M01), clone 2C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SQSTM1.
- Antigen sequence
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEA
EAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDE
DGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKEC
RRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRY
KCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHL
SEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRP
PRAGEARPGPTAESASGPSEDPSVNFLKNVGESVA
AALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEE
KSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIA
LESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPST
GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPH
LPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL- Isotype
- IgG
- Antibody clone number
- 2C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Loss of OMA1 delays neurodegeneration by preventing stress-induced OPA1 processing in mitochondria.
Oncolytic Adenovirus Loaded with L-carnosine as Novel Strategy to Enhance the Antitumor Activity.
Lithium Decreases Glial Fibrillary Acidic Protein in a Mouse Model of Alexander Disease.
Basal Autophagy and Feedback Activation of Akt Are Associated with Resistance to Metformin-Induced Inhibition of Hepatic Tumor Cell Growth.
Streptococcus pneumoniae induces autophagy through the inhibition of the PI3K-I/Akt/mTOR pathway and ROS hypergeneration in A549 cells.
Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.
Caspase-2 protects against oxidative stress in vivo.
Autophagy mediates degradation of nuclear lamina.
Graphene oxide as a chemosensitizer: diverted autophagic flux, enhanced nuclear import, elevated necrosis and improved antitumor effects.
FGF signalling regulates bone growth through autophagy.
Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases.
3D bioprinting of biomimetic aortic vascular constructs with self-supporting cells.
Unsaturated fatty acids induce non-canonical autophagy.
Role of hypoxia inducing factor-1β in alcohol-induced autophagy, steatosis and liver injury in mice.
Regulation of YAP by mTOR and autophagy reveals a therapeutic target of tuberous sclerosis complex.
Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation.
Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy.
Melatonin administration decreases adipogenesis in the liver of ob/ob mice through autophagy modulation.
The non-receptor tyrosine kinase Ack1 regulates the fate of activated EGFR by inducing trafficking to the p62/NBR1 pre-autophagosome.
Defective autophagy impairs ATF3 activity and worsens lung injury during endotoxemia.
Impairment of autophagy in endothelial cells prevents shear-stress-induced increases in nitric oxide bioavailability.
Dual role for CHOP in the crosstalk between autophagy and apoptosis to determine cell fate in response to amino acid deprivation.
Autophagy variation within a cell population determines cell fate through selective degradation of Fap-1.
Reactive oxygen species regulation of autophagy in skeletal muscles.
p62/SQSTM1 is required for cell survival of apoptosis-resistant bone metastatic prostate cancer cell lines.
Presenilin-1 regulates the expression of p62 to govern p62-dependent tau degradation.
New autophagy reporter mice reveal dynamics of proximal tubular autophagy.
Suppression of autophagic flux by bile acids in hepatocytes.
Clinicopathologic report of ocular involvement in ALS patients with C9orf72 mutation.
IL-1β induces p62/SQSTM1 and represses androgen receptor expression in prostate cancer cells.
p62/SQSTM1 enhances NOD2-mediated signaling and cytokine production through stabilizing NOD2 oligomerization.
MIR376A is a regulator of starvation-induced autophagy.
Impairment of autophagic flux promotes glucose reperfusion-induced neuro2A cell death after glucose deprivation.
Regulation of mammalian autophagy by class II and III PI 3-kinases through PI3P synthesis.
Dysregulation of autophagy in chronic lymphocytic leukemia with the small-molecule Sirtuin inhibitor Tenovin-6.
The eIF2α/ATF4 pathway is essential for stress-induced autophagy gene expression.
The ubiquitin ligase parkin mediates resistance to intracellular pathogens.
Site-specific Mtm1 mutagenesis by an AAV-Cre vector reveals that myotubularin is essential in adult muscle.
Dopamine and its metabolites in cathepsin D heterozygous mice before and after MPTP administration.
RalGDS-dependent cardiomyocyte autophagy is required for load-induced ventricular hypertrophy.
Signalling pathways regulating muscle mass in ageing skeletal muscle: the role of the IGF1-Akt-mTOR-FoxO pathway.
Impairment of autophagy decreases ventilator-induced lung injury by blockade of the NF-κB pathway.
Recombinant protein rVP1 upregulates BECN1-independent autophagy, MAPK1/3 phosphorylation and MMP9 activity via WIPI1/WIPI2 to promote macrophage migration.
Defective autophagy and mTORC1 signaling in myotubularin null mice.
Host cell autophagy modulates early stages of adenovirus infections in airway epithelial cells.
Hyperactivation of the mammalian degenerin MDEG promotes caspase-8 activation and apoptosis.
Autophagic-lysosomal pathway is the main proteolytic system modified in the skeletal muscle of esophageal cancer patients.
Critical role of FoxO3a in alcohol-induced autophagy and hepatotoxicity.
C9orf72 frontotemporal lobar degeneration is characterised by frequent neuronal sense and antisense RNA foci.
Autosis is a Na+,K+-ATPase-regulated form of cell death triggered by autophagy-inducing peptides, starvation, and hypoxia-ischemia.
West Nile virus (WNV) replication is independent of autophagy in mammalian cells.
Tissue specific induction of p62/Sqstm1 by farnesoid X receptor.
Genetic ablation of Nrf2/antioxidant response pathway in Alexander disease mice reduces hippocampal gliosis but does not impact survival.
(-)-Epigallocatechin-3-gallate induces non-apoptotic cell death in human cancer cells via ROS-mediated lysosomal membrane permeabilization.
MAP1B Interaction with the FW Domain of the Autophagic Receptor Nbr1 Facilitates Its Association to the Microtubule Network.
Autophagic degradation of tau in primary neurons and its enhancement by trehalose.
Sorafenib has potent antitumor activity against multiple myeloma in vitro, ex vivo, and in vivo in the 5T33MM mouse model.
Cathepsin cleavage of sirtuin 1 in endothelial progenitor cells mediates stress-induced premature senescence.
Progressive neuronal inclusion formation and axonal degeneration in CHMP2B mutant transgenic mice.
Chronic activation of mTOR complex 1 is sufficient to cause hepatocellular carcinoma in mice.
A centronuclear myopathy--dynamin 2 mutation impairs autophagy in mice.
Liver-specific loss of Atg5 causes persistent activation of Nrf2 and protects against acetaminophen-induced liver injury.
Autophagy promotes T-cell survival through degradation of proteins of the cell death machinery.
Modulation of pediatric brain tumor autophagy and chemosensitivity.
Targeting of distinct signaling cascades and cancer-associated fibroblasts define the efficacy of Sorafenib against prostate cancer cells.
Class III PI3K Vps34 plays an essential role in autophagy and in heart and liver function.
Astrocyte-specific overexpression of Nrf2 delays motor pathology and synuclein aggregation throughout the CNS in the alpha-synuclein mutant (A53T) mouse model.
Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia.
Pancreatic cancers require autophagy for tumor growth.
Neighbor of Brca1 gene (Nbr1) functions as a negative regulator of postnatal osteoblastic bone formation and p38 MAPK activity.
In vivo requirement for Atg5 in antigen presentation by dendritic cells.
14-3-3Tau regulates Beclin 1 and is required for autophagy.
Dual role of 3-methyladenine in modulation of autophagy via different temporal patterns of inhibition on class I and III phosphoinositide 3-kinase.
Monitoring autophagic degradation of p62/SQSTM1.
Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.
Sequestosome 1/p62 links familial ALS mutant SOD1 to LC3 via an ubiquitin-independent mechanism.
Defective autophagy in neurons and astrocytes from mice deficient in PI(3,5)P2.
Loss of autophagy diminishes pancreatic beta cell mass and function with resultant hyperglycemia.
Korwitz A, Merkwirth C, Richter-Dennerlein R, Tröder SE, Sprenger HG, Quirós PM, López-Otín C, Rugarli EI, Langer T
The Journal of cell biology 2016 Jan 18;212(2):157-66
The Journal of cell biology 2016 Jan 18;212(2):157-66
Oncolytic Adenovirus Loaded with L-carnosine as Novel Strategy to Enhance the Antitumor Activity.
Garofalo M, Iovine B, Kuryk L, Capasso C, Hirvinen M, Vitale A, Yliperttula M, Bevilacqua MA, Cerullo V
Molecular cancer therapeutics 2016 Apr;15(4):651-60
Molecular cancer therapeutics 2016 Apr;15(4):651-60
Lithium Decreases Glial Fibrillary Acidic Protein in a Mouse Model of Alexander Disease.
LaPash Daniels CM, Paffenroth E, Austin EV, Glebov K, Lewis D, Walter J, Messing A
PloS one 2015;10(9):e0138132
PloS one 2015;10(9):e0138132
Basal Autophagy and Feedback Activation of Akt Are Associated with Resistance to Metformin-Induced Inhibition of Hepatic Tumor Cell Growth.
Yang H, Peng YF, Ni HM, Li Y, Shi YH, Ding WX, Fan J
PloS one 2015;10(6):e0130953
PloS one 2015;10(6):e0130953
Streptococcus pneumoniae induces autophagy through the inhibition of the PI3K-I/Akt/mTOR pathway and ROS hypergeneration in A549 cells.
Li P, Shi J, He Q, Hu Q, Wang YY, Zhang LJ, Chan WT, Chen WX
PloS one 2015;10(3):e0122753
PloS one 2015;10(3):e0122753
Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.
Nemazanyy I, Montagnac G, Russell RC, Morzyglod L, Burnol AF, Guan KL, Pende M, Panasyuk G
Nature communications 2015 Sep 21;6:8283
Nature communications 2015 Sep 21;6:8283
Caspase-2 protects against oxidative stress in vivo.
Shalini S, Puccini J, Wilson CH, Finnie J, Dorstyn L, Kumar S
Oncogene 2015 Sep 17;34(38):4995-5002
Oncogene 2015 Sep 17;34(38):4995-5002
Autophagy mediates degradation of nuclear lamina.
Dou Z, Xu C, Donahue G, Shimi T, Pan JA, Zhu J, Ivanov A, Capell BC, Drake AM, Shah PP, Catanzaro JM, Ricketts MD, Lamark T, Adam SA, Marmorstein R, Zong WX, Johansen T, Goldman RD, Adams PD, Berger SL
Nature 2015 Nov 5;527(7576):105-9
Nature 2015 Nov 5;527(7576):105-9
Graphene oxide as a chemosensitizer: diverted autophagic flux, enhanced nuclear import, elevated necrosis and improved antitumor effects.
Chen GY, Meng CL, Lin KC, Tuan HY, Yang HJ, Chen CL, Li KC, Chiang CS, Hu YC
Biomaterials 2015 Feb;40:12-22
Biomaterials 2015 Feb;40:12-22
FGF signalling regulates bone growth through autophagy.
Cinque L, Forrester A, Bartolomeo R, Svelto M, Venditti R, Montefusco S, Polishchuk E, Nusco E, Rossi A, Medina DL, Polishchuk R, De Matteis MA, Settembre C
Nature 2015 Dec 10;528(7581):272-5
Nature 2015 Dec 10;528(7581):272-5
Drosha inclusions are new components of dipeptide-repeat protein aggregates in FTLD-TDP and ALS C9orf72 expansion cases.
Porta S, Kwong LK, Trojanowski JQ, Lee VM
Journal of neuropathology and experimental neurology 2015 Apr;74(4):380-7
Journal of neuropathology and experimental neurology 2015 Apr;74(4):380-7
3D bioprinting of biomimetic aortic vascular constructs with self-supporting cells.
Kucukgul C, Ozler SB, Inci I, Karakas E, Irmak S, Gozuacik D, Taralp A, Koc B
Biotechnology and bioengineering 2015 Apr;112(4):811-21
Biotechnology and bioengineering 2015 Apr;112(4):811-21
Unsaturated fatty acids induce non-canonical autophagy.
Niso-Santano M, Malik SA, Pietrocola F, Bravo-San Pedro JM, Mariño G, Cianfanelli V, Ben-Younès A, Troncoso R, Markaki M, Sica V, Izzo V, Chaba K, Bauvy C, Dupont N, Kepp O, Rockenfeller P, Wolinski H, Madeo F, Lavandero S, Codogno P, Harper F, Pierron G, Tavernarakis N, Cecconi F, Maiuri MC, Galluzzi L, Kroemer G
The EMBO journal 2015 Apr 15;34(8):1025-41
The EMBO journal 2015 Apr 15;34(8):1025-41
Role of hypoxia inducing factor-1β in alcohol-induced autophagy, steatosis and liver injury in mice.
Ni HM, Bhakta A, Wang S, Li Z, Manley S, Huang H, Copple B, Ding WX
PloS one 2014;9(12):e115849
PloS one 2014;9(12):e115849
Regulation of YAP by mTOR and autophagy reveals a therapeutic target of tuberous sclerosis complex.
Liang N, Zhang C, Dill P, Panasyuk G, Pion D, Koka V, Gallazzini M, Olson EN, Lam H, Henske EP, Dong Z, Apte U, Pallet N, Johnson RL, Terzi F, Kwiatkowski DJ, Scoazec JY, Martignoni G, Pende M
The Journal of experimental medicine 2014 Oct 20;211(11):2249-63
The Journal of experimental medicine 2014 Oct 20;211(11):2249-63
Impaired OMA1-dependent cleavage of OPA1 and reduced DRP1 fission activity combine to prevent mitophagy in cells that are dependent on oxidative phosphorylation.
MacVicar TD, Lane JD
Journal of cell science 2014 May 15;127(Pt 10):2313-25
Journal of cell science 2014 May 15;127(Pt 10):2313-25
Quantitative proteomics identifies NCOA4 as the cargo receptor mediating ferritinophagy.
Mancias JD, Wang X, Gygi SP, Harper JW, Kimmelman AC
Nature 2014 May 1;509(7498):105-9
Nature 2014 May 1;509(7498):105-9
Melatonin administration decreases adipogenesis in the liver of ob/ob mice through autophagy modulation.
de Luxán-Delgado B, Caballero B, Potes Y, Rubio-González A, Rodríguez I, Gutiérrez-Rodríguez J, Solano JJ, Coto-Montes A
Journal of pineal research 2014 Mar;56(2):126-33
Journal of pineal research 2014 Mar;56(2):126-33
The non-receptor tyrosine kinase Ack1 regulates the fate of activated EGFR by inducing trafficking to the p62/NBR1 pre-autophagosome.
Jones S, Cunningham DL, Rappoport JZ, Heath JK
Journal of cell science 2014 Mar 1;127(Pt 5):994-1006
Journal of cell science 2014 Mar 1;127(Pt 5):994-1006
Defective autophagy impairs ATF3 activity and worsens lung injury during endotoxemia.
Aguirre A, López-Alonso I, González-López A, Amado-Rodríguez L, Batalla-Solís E, Astudillo A, Blázquez-Prieto J, Fernández AF, Galván JA, dos Santos CC, Albaiceta GM
Journal of molecular medicine (Berlin, Germany) 2014 Jun;92(6):665-76
Journal of molecular medicine (Berlin, Germany) 2014 Jun;92(6):665-76
Impairment of autophagy in endothelial cells prevents shear-stress-induced increases in nitric oxide bioavailability.
Bharath LP, Mueller R, Li Y, Ruan T, Kunz D, Goodrich R, Mills T, Deeter L, Sargsyan A, Anandh Babu PV, Graham TE, Symons JD
Canadian journal of physiology and pharmacology 2014 Jul;92(7):605-12
Canadian journal of physiology and pharmacology 2014 Jul;92(7):605-12
Dual role for CHOP in the crosstalk between autophagy and apoptosis to determine cell fate in response to amino acid deprivation.
B'chir W, Chaveroux C, Carraro V, Averous J, Maurin AC, Jousse C, Muranishi Y, Parry L, Fafournoux P, Bruhat A
Cellular signalling 2014 Jul;26(7):1385-91
Cellular signalling 2014 Jul;26(7):1385-91
Autophagy variation within a cell population determines cell fate through selective degradation of Fap-1.
Gump JM, Staskiewicz L, Morgan MJ, Bamberg A, Riches DW, Thorburn A
Nature cell biology 2014 Jan;16(1):47-54
Nature cell biology 2014 Jan;16(1):47-54
Reactive oxygen species regulation of autophagy in skeletal muscles.
Rahman M, Mofarrahi M, Kristof AS, Nkengfac B, Harel S, Hussain SN
Antioxidants & redox signaling 2014 Jan 20;20(3):443-59
Antioxidants & redox signaling 2014 Jan 20;20(3):443-59
p62/SQSTM1 is required for cell survival of apoptosis-resistant bone metastatic prostate cancer cell lines.
Chang MA, Morgado M, Warren CR, Hinton CV, Farach-Carson MC, Delk NA
The Prostate 2014 Feb;74(2):149-63
The Prostate 2014 Feb;74(2):149-63
Presenilin-1 regulates the expression of p62 to govern p62-dependent tau degradation.
Tung YT, Wang BJ, Hsu WM, Hu MK, Her GM, Huang WP, Liao YF
Molecular neurobiology 2014 Feb;49(1):10-27
Molecular neurobiology 2014 Feb;49(1):10-27
New autophagy reporter mice reveal dynamics of proximal tubular autophagy.
Li L, Wang ZV, Hill JA, Lin F
Journal of the American Society of Nephrology : JASN 2014 Feb;25(2):305-15
Journal of the American Society of Nephrology : JASN 2014 Feb;25(2):305-15
Suppression of autophagic flux by bile acids in hepatocytes.
Manley S, Ni HM, Kong B, Apte U, Guo G, Ding WX
Toxicological sciences : an official journal of the Society of Toxicology 2014 Feb;137(2):478-90
Toxicological sciences : an official journal of the Society of Toxicology 2014 Feb;137(2):478-90
Clinicopathologic report of ocular involvement in ALS patients with C9orf72 mutation.
Fawzi AA, Simonett JM, Purta P, Moss HE, Lowry JL, Deng HX, Siddique N, Sufit R, Bigio EH, Volpe NJ, Siddique T
Amyotrophic lateral sclerosis & frontotemporal degeneration 2014 Dec;15(7-8):569-80
Amyotrophic lateral sclerosis & frontotemporal degeneration 2014 Dec;15(7-8):569-80
IL-1β induces p62/SQSTM1 and represses androgen receptor expression in prostate cancer cells.
Chang MA, Patel V, Gwede M, Morgado M, Tomasevich K, Fong EL, Farach-Carson MC, Delk NA
Journal of cellular biochemistry 2014 Dec;115(12):2188-97
Journal of cellular biochemistry 2014 Dec;115(12):2188-97
p62/SQSTM1 enhances NOD2-mediated signaling and cytokine production through stabilizing NOD2 oligomerization.
Park S, Ha SD, Coleman M, Meshkibaf S, Kim SO
PloS one 2013;8(2):e57138
PloS one 2013;8(2):e57138
MIR376A is a regulator of starvation-induced autophagy.
Korkmaz G, Tekirdag KA, Ozturk DG, Kosar A, Sezerman OU, Gozuacik D
PloS one 2013;8(12):e82556
PloS one 2013;8(12):e82556
Impairment of autophagic flux promotes glucose reperfusion-induced neuro2A cell death after glucose deprivation.
Jang BG, Choi BY, Kim JH, Kim MJ, Sohn M, Suh SW
PloS one 2013;8(10):e76466
PloS one 2013;8(10):e76466
Regulation of mammalian autophagy by class II and III PI 3-kinases through PI3P synthesis.
Devereaux K, Dall'Armi C, Alcazar-Roman A, Ogasawara Y, Zhou X, Wang F, Yamamoto A, De Camilli P, Di Paolo G
PloS one 2013;8(10):e76405
PloS one 2013;8(10):e76405
Dysregulation of autophagy in chronic lymphocytic leukemia with the small-molecule Sirtuin inhibitor Tenovin-6.
MacCallum SF, Groves MJ, James J, Murray K, Appleyard V, Prescott AR, Drbal AA, Nicolaou A, Cunningham J, Haydock S, Ganley IG, Westwood NJ, Coates PJ, Lain S, Tauro S
Scientific reports 2013;3:1275
Scientific reports 2013;3:1275
The eIF2α/ATF4 pathway is essential for stress-induced autophagy gene expression.
B'chir W, Maurin AC, Carraro V, Averous J, Jousse C, Muranishi Y, Parry L, Stepien G, Fafournoux P, Bruhat A
Nucleic acids research 2013 Sep;41(16):7683-99
Nucleic acids research 2013 Sep;41(16):7683-99
The ubiquitin ligase parkin mediates resistance to intracellular pathogens.
Manzanillo PS, Ayres JS, Watson RO, Collins AC, Souza G, Rae CS, Schneider DS, Nakamura K, Shiloh MU, Cox JS
Nature 2013 Sep 26;501(7468):512-6
Nature 2013 Sep 26;501(7468):512-6
Site-specific Mtm1 mutagenesis by an AAV-Cre vector reveals that myotubularin is essential in adult muscle.
Joubert R, Vignaud A, Le M, Moal C, Messaddeq N, Buj-Bello A
Human molecular genetics 2013 May 1;22(9):1856-66
Human molecular genetics 2013 May 1;22(9):1856-66
Dopamine and its metabolites in cathepsin D heterozygous mice before and after MPTP administration.
Crabtree D, Boyer-Guittaut M, Ouyang X, Fineberg N, Zhang J
Neuroscience letters 2013 Mar 22;538:3-8
Neuroscience letters 2013 Mar 22;538:3-8
RalGDS-dependent cardiomyocyte autophagy is required for load-induced ventricular hypertrophy.
Rifki OF, Bodemann BO, Battiprolu PK, White MA, Hill JA
Journal of molecular and cellular cardiology 2013 Jun;59:128-38
Journal of molecular and cellular cardiology 2013 Jun;59:128-38
Signalling pathways regulating muscle mass in ageing skeletal muscle: the role of the IGF1-Akt-mTOR-FoxO pathway.
Sandri M, Barberi L, Bijlsma AY, Blaauw B, Dyar KA, Milan G, Mammucari C, Meskers CG, Pallafacchina G, Paoli A, Pion D, Roceri M, Romanello V, Serrano AL, Toniolo L, Larsson L, Maier AB, Muñoz-Cánoves P, Musarò A, Pende M, Reggiani C, Rizzuto R, Schiaffino S
Biogerontology 2013 Jun;14(3):303-23
Biogerontology 2013 Jun;14(3):303-23
Impairment of autophagy decreases ventilator-induced lung injury by blockade of the NF-κB pathway.
López-Alonso I, Aguirre A, González-López A, Fernández ÁF, Amado-Rodríguez L, Astudillo A, Batalla-Solís E, Albaiceta GM
American journal of physiology. Lung cellular and molecular physiology 2013 Jun 15;304(12):L844-52
American journal of physiology. Lung cellular and molecular physiology 2013 Jun 15;304(12):L844-52
Recombinant protein rVP1 upregulates BECN1-independent autophagy, MAPK1/3 phosphorylation and MMP9 activity via WIPI1/WIPI2 to promote macrophage migration.
Liao CC, Ho MY, Liang SM, Liang CM
Autophagy 2013 Jan;9(1):5-19
Autophagy 2013 Jan;9(1):5-19
Defective autophagy and mTORC1 signaling in myotubularin null mice.
Fetalvero KM, Yu Y, Goetschkes M, Liang G, Valdez RA, Gould T, Triantafellow E, Bergling S, Loureiro J, Eash J, Lin V, Porter JA, Finan PM, Walsh K, Yang Y, Mao X, Murphy LO
Molecular and cellular biology 2013 Jan;33(1):98-110
Molecular and cellular biology 2013 Jan;33(1):98-110
Host cell autophagy modulates early stages of adenovirus infections in airway epithelial cells.
Zeng X, Carlin CR
Journal of virology 2013 Feb;87(4):2307-19
Journal of virology 2013 Feb;87(4):2307-19
Hyperactivation of the mammalian degenerin MDEG promotes caspase-8 activation and apoptosis.
Pan JA, Fan Y, Gandhirajan RK, Madesh M, Zong WX
The Journal of biological chemistry 2013 Feb 1;288(5):2952-63
The Journal of biological chemistry 2013 Feb 1;288(5):2952-63
Autophagic-lysosomal pathway is the main proteolytic system modified in the skeletal muscle of esophageal cancer patients.
Tardif N, Klaude M, Lundell L, Thorell A, Rooyackers O
The American journal of clinical nutrition 2013 Dec;98(6):1485-92
The American journal of clinical nutrition 2013 Dec;98(6):1485-92
Critical role of FoxO3a in alcohol-induced autophagy and hepatotoxicity.
Ni HM, Du K, You M, Ding WX
The American journal of pathology 2013 Dec;183(6):1815-25
The American journal of pathology 2013 Dec;183(6):1815-25
C9orf72 frontotemporal lobar degeneration is characterised by frequent neuronal sense and antisense RNA foci.
Mizielinska S, Lashley T, Norona FE, Clayton EL, Ridler CE, Fratta P, Isaacs AM
Acta neuropathologica 2013 Dec;126(6):845-57
Acta neuropathologica 2013 Dec;126(6):845-57
Autosis is a Na+,K+-ATPase-regulated form of cell death triggered by autophagy-inducing peptides, starvation, and hypoxia-ischemia.
Liu Y, Shoji-Kawata S, Sumpter RM Jr, Wei Y, Ginet V, Zhang L, Posner B, Tran KA, Green DR, Xavier RJ, Shaw SY, Clarke PG, Puyal J, Levine B
Proceedings of the National Academy of Sciences of the United States of America 2013 Dec 17;110(51):20364-71
Proceedings of the National Academy of Sciences of the United States of America 2013 Dec 17;110(51):20364-71
West Nile virus (WNV) replication is independent of autophagy in mammalian cells.
Vandergaast R, Fredericksen BL
PloS one 2012;7(9):e45800
PloS one 2012;7(9):e45800
Tissue specific induction of p62/Sqstm1 by farnesoid X receptor.
Williams JA, Thomas AM, Li G, Kong B, Zhan L, Inaba Y, Xie W, Ding WX, Guo GL
PloS one 2012;7(8):e43961
PloS one 2012;7(8):e43961
Genetic ablation of Nrf2/antioxidant response pathway in Alexander disease mice reduces hippocampal gliosis but does not impact survival.
Hagemann TL, Jobe EM, Messing A
PloS one 2012;7(5):e37304
PloS one 2012;7(5):e37304
(-)-Epigallocatechin-3-gallate induces non-apoptotic cell death in human cancer cells via ROS-mediated lysosomal membrane permeabilization.
Zhang Y, Yang ND, Zhou F, Shen T, Duan T, Zhou J, Shi Y, Zhu XQ, Shen HM
PloS one 2012;7(10):e46749
PloS one 2012;7(10):e46749
MAP1B Interaction with the FW Domain of the Autophagic Receptor Nbr1 Facilitates Its Association to the Microtubule Network.
Marchbank K, Waters S, Roberts RG, Solomon E, Whitehouse CA
International journal of cell biology 2012;2012:208014
International journal of cell biology 2012;2012:208014
Autophagic degradation of tau in primary neurons and its enhancement by trehalose.
Krüger U, Wang Y, Kumar S, Mandelkow EM
Neurobiology of aging 2012 Oct;33(10):2291-305
Neurobiology of aging 2012 Oct;33(10):2291-305
Sorafenib has potent antitumor activity against multiple myeloma in vitro, ex vivo, and in vivo in the 5T33MM mouse model.
Kharaziha P, De Raeve H, Fristedt C, Li Q, Gruber A, Johnsson P, Kokaraki G, Panzar M, Laane E, Osterborg A, Zhivotovsky B, Jernberg-Wiklund H, Grandér D, Celsing F, Björkholm M, Vanderkerken K, Panaretakis T
Cancer research 2012 Oct 15;72(20):5348-62
Cancer research 2012 Oct 15;72(20):5348-62
Cathepsin cleavage of sirtuin 1 in endothelial progenitor cells mediates stress-induced premature senescence.
Chen J, Xavier S, Moskowitz-Kassai E, Chen R, Lu CY, Sanduski K, Špes A, Turk B, Goligorsky MS
The American journal of pathology 2012 Mar;180(3):973-83
The American journal of pathology 2012 Mar;180(3):973-83
Progressive neuronal inclusion formation and axonal degeneration in CHMP2B mutant transgenic mice.
Ghazi-Noori S, Froud KE, Mizielinska S, Powell C, Smidak M, Fernandez de Marco M, O'Malley C, Farmer M, Parkinson N, Fisher EM, Asante EA, Brandner S, Collinge J, Isaacs AM
Brain : a journal of neurology 2012 Mar;135(Pt 3):819-32
Brain : a journal of neurology 2012 Mar;135(Pt 3):819-32
Chronic activation of mTOR complex 1 is sufficient to cause hepatocellular carcinoma in mice.
Menon S, Yecies JL, Zhang HH, Howell JJ, Nicholatos J, Harputlugil E, Bronson RT, Kwiatkowski DJ, Manning BD
Science signaling 2012 Mar 27;5(217):ra24
Science signaling 2012 Mar 27;5(217):ra24
A centronuclear myopathy--dynamin 2 mutation impairs autophagy in mice.
Durieux AC, Vassilopoulos S, Lainé J, Fraysse B, Briñas L, Prudhon B, Castells J, Freyssenet D, Bonne G, Guicheney P, Bitoun M
Traffic (Copenhagen, Denmark) 2012 Jun;13(6):869-79
Traffic (Copenhagen, Denmark) 2012 Jun;13(6):869-79
Liver-specific loss of Atg5 causes persistent activation of Nrf2 and protects against acetaminophen-induced liver injury.
Ni HM, Boggess N, McGill MR, Lebofsky M, Borude P, Apte U, Jaeschke H, Ding WX
Toxicological sciences : an official journal of the Society of Toxicology 2012 Jun;127(2):438-50
Toxicological sciences : an official journal of the Society of Toxicology 2012 Jun;127(2):438-50
Autophagy promotes T-cell survival through degradation of proteins of the cell death machinery.
Kovacs JR, Li C, Yang Q, Li G, Garcia IG, Ju S, Roodman DG, Windle JJ, Zhang X, Lu B
Cell death and differentiation 2012 Jan;19(1):144-52
Cell death and differentiation 2012 Jan;19(1):144-52
Modulation of pediatric brain tumor autophagy and chemosensitivity.
Levy JM, Thorburn A
Journal of neuro-oncology 2012 Jan;106(2):281-90
Journal of neuro-oncology 2012 Jan;106(2):281-90
Targeting of distinct signaling cascades and cancer-associated fibroblasts define the efficacy of Sorafenib against prostate cancer cells.
Kharaziha P, Rodriguez P, Li Q, Rundqvist H, Björklund AC, Augsten M, Ullén A, Egevad L, Wiklund P, Nilsson S, Kroemer G, Grander D, Panaretakis T
Cell death & disease 2012 Jan 26;3:e262
Cell death & disease 2012 Jan 26;3:e262
Class III PI3K Vps34 plays an essential role in autophagy and in heart and liver function.
Jaber N, Dou Z, Chen JS, Catanzaro J, Jiang YP, Ballou LM, Selinger E, Ouyang X, Lin RZ, Zhang J, Zong WX
Proceedings of the National Academy of Sciences of the United States of America 2012 Feb 7;109(6):2003-8
Proceedings of the National Academy of Sciences of the United States of America 2012 Feb 7;109(6):2003-8
Astrocyte-specific overexpression of Nrf2 delays motor pathology and synuclein aggregation throughout the CNS in the alpha-synuclein mutant (A53T) mouse model.
Gan L, Vargas MR, Johnson DA, Johnson JA
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 5;32(49):17775-87
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 5;32(49):17775-87
Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia.
Deng HX, Chen W, Hong ST, Boycott KM, Gorrie GH, Siddique N, Yang Y, Fecto F, Shi Y, Zhai H, Jiang H, Hirano M, Rampersaud E, Jansen GH, Donkervoort S, Bigio EH, Brooks BR, Ajroud K, Sufit RL, Haines JL, Mugnaini E, Pericak-Vance MA, Siddique T
Nature 2011 Aug 21;477(7363):211-5
Nature 2011 Aug 21;477(7363):211-5
Pancreatic cancers require autophagy for tumor growth.
Yang S, Wang X, Contino G, Liesa M, Sahin E, Ying H, Bause A, Li Y, Stommel JM, Dell'antonio G, Mautner J, Tonon G, Haigis M, Shirihai OS, Doglioni C, Bardeesy N, Kimmelman AC
Genes & development 2011 Apr 1;25(7):717-29
Genes & development 2011 Apr 1;25(7):717-29
Neighbor of Brca1 gene (Nbr1) functions as a negative regulator of postnatal osteoblastic bone formation and p38 MAPK activity.
Whitehouse CA, Waters S, Marchbank K, Horner A, McGowan NW, Jovanovic JV, Xavier GM, Kashima TG, Cobourne MT, Richards GO, Sharpe PT, Skerry TM, Grigoriadis AE, Solomon E
Proceedings of the National Academy of Sciences of the United States of America 2010 Jul 20;107(29):12913-8
Proceedings of the National Academy of Sciences of the United States of America 2010 Jul 20;107(29):12913-8
In vivo requirement for Atg5 in antigen presentation by dendritic cells.
Lee HK, Mattei LM, Steinberg BE, Alberts P, Lee YH, Chervonsky A, Mizushima N, Grinstein S, Iwasaki A
Immunity 2010 Feb 26;32(2):227-39
Immunity 2010 Feb 26;32(2):227-39
14-3-3Tau regulates Beclin 1 and is required for autophagy.
Wang B, Ling S, Lin WC
PloS one 2010 Apr 29;5(4):e10409
PloS one 2010 Apr 29;5(4):e10409
Dual role of 3-methyladenine in modulation of autophagy via different temporal patterns of inhibition on class I and III phosphoinositide 3-kinase.
Wu YT, Tan HL, Shui G, Bauvy C, Huang Q, Wenk MR, Ong CN, Codogno P, Shen HM
The Journal of biological chemistry 2010 Apr 2;285(14):10850-61
The Journal of biological chemistry 2010 Apr 2;285(14):10850-61
Monitoring autophagic degradation of p62/SQSTM1.
Bjørkøy G, Lamark T, Pankiv S, Øvervatn A, Brech A, Johansen T
Methods in enzymology 2009;452:181-97
Methods in enzymology 2009;452:181-97
Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.
Mardakheh FK, Yekezare M, Machesky LM, Heath JK
The Journal of cell biology 2009 Oct 19;187(2):265-77
The Journal of cell biology 2009 Oct 19;187(2):265-77
Sequestosome 1/p62 links familial ALS mutant SOD1 to LC3 via an ubiquitin-independent mechanism.
Gal J, Ström AL, Kwinter DM, Kilty R, Zhang J, Shi P, Fu W, Wooten MW, Zhu H
Journal of neurochemistry 2009 Nov;111(4):1062-73
Journal of neurochemistry 2009 Nov;111(4):1062-73
Defective autophagy in neurons and astrocytes from mice deficient in PI(3,5)P2.
Ferguson CJ, Lenk GM, Meisler MH
Human molecular genetics 2009 Dec 15;18(24):4868-78
Human molecular genetics 2009 Dec 15;18(24):4868-78
Loss of autophagy diminishes pancreatic beta cell mass and function with resultant hyperglycemia.
Jung HS, Chung KW, Won Kim J, Kim J, Komatsu M, Tanaka K, Nguyen YH, Kang TM, Yoon KH, Kim JW, Jeong YT, Han MS, Lee MK, Kim KW, Shin J, Lee MS
Cell metabolism 2008 Oct;8(4):318-24
Cell metabolism 2008 Oct;8(4):318-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SQSTM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SQSTM1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
