Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010576-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010576-M01, RRID:AB_464292
- Product name
- CCT2 monoclonal antibody (M01), clone 2G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCT2.
- Antigen sequence
IAKKIHPQTIIAGWREATKAAREALLSSAVDHGSD
EVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEA
VLRLKGSGNLEAIHIIKKLGGSLADSYLDEG- Isotype
- IgG
- Antibody clone number
- 2G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Reconstitution of the human chaperonin CCT by co-expression of the eight distinct subunits in mammalian cells.
BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly.
Machida K, Masutani M, Kobayashi T, Mikami S, Nishino Y, Miyazawa A, Imataka H
Protein expression and purification 2012 Mar;82(1):61-9
Protein expression and purification 2012 Mar;82(1):61-9
BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly.
Seo S, Baye LM, Schulz NP, Beck JS, Zhang Q, Slusarski DC, Sheffield VC
Proceedings of the National Academy of Sciences of the United States of America 2010 Jan 26;107(4):1488-93
Proceedings of the National Academy of Sciences of the United States of America 2010 Jan 26;107(4):1488-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CCT2 monoclonal antibody (M01), clone 2G6 Western Blot analysis of CCT2 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CCT2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CCT2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CCT2 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
