Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002560 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002560, RRID:AB_1856717
- Product name
- Anti-SERPINA3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPK
FSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR
NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSA
LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
KQEGAPHR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A molecular profile of cocaine abuse includes the differential expression of genes that regulate transcription, chromatin, and dopamine cell phenotype.
Antibody-based profiling of cerebrospinal fluid within multiple sclerosis
Bannon MJ, Johnson MM, Michelhaugh SK, Hartley ZJ, Halter SD, David JA, Kapatos G, Schmidt CJ
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2014 Aug;39(9):2191-9
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2014 Aug;39(9):2191-9
Antibody-based profiling of cerebrospinal fluid within multiple sclerosis
Häggmark A, Byström S, Ayoglu B, Qundos U, Uhlén M, Khademi M, Olsson T, Schwenk J, Nilsson P
PROTEOMICS 2013 August;13(15):2256-2267
PROTEOMICS 2013 August;13(15):2256-2267
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, cervix, uterine, colon and liver using Anti-SERPINA3 antibody HPA002560 (A) shows similar protein distribution across tissues to independent antibody HPA000893 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic and extracellular positivity in cells of tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine using Anti-SERPINA3 antibody HPA002560.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-SERPINA3 antibody HPA002560.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-SERPINA3 antibody HPA002560.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-SERPINA3 antibody HPA002560.
- Sample type
- HUMAN