WH0009736M1

USP34 antibody from MilliporeSigma / Merck KGaA
KIAA0570, KIAA0729
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0009736M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0009736M1, RRID:AB_1844178
Product name
Monoclonal Anti-USP34 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0009736M1
Antibody type
Monoclonal
Antigen
USP34 (NP_055524, a.a. 3296-3396) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLA
DLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQ
HDILDTLCRTIESTIHVVTRISGKGNQAAS* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -