Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009736-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009736-A01, RRID:AB_463103
- Product name
- USP34 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant USP34.
- Antigen sequence
CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLA
DLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQ
HDILDTLCRTIESTIHVVTRISGKGNQAAS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data