HPA070764

USP34 antibody from Atlas Antibodies
KIAA0570, KIAA0729

Antibody data

Product number
HPA070764
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA070764, RRID:AB_2686308
Product name
Anti-USP34
Provider product page
Atlas Antibodies - HPA070764
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEY
IKCILMDERTFLNNNIVYTFMTHFLLKVQSQVFSE
ANCANLISTLITNLISQYQNLQSDFSNRV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -