Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001238 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001238, RRID:AB_1079398
- Product name
- Anti-MMP9
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYT
RVAEMRGESKSLGPALLLLQKQLSLPETGELDSAT
LKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWI
QNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVY
SRDADI- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Investigation of potential early Histologic markers of pediatric inflammatory bowel disease.
Histone deacetylase (HDAC) 10 suppresses cervical cancer metastasis through inhibition of matrix metalloproteinase (MMP) 2 and 9 expression.
Bass JA, Friesen CA, Deacy AD, Neilan NA, Bracken JM, Shakhnovich V, Singh V
BMC gastroenterology 2015 Oct 13;15:129
BMC gastroenterology 2015 Oct 13;15:129
Histone deacetylase (HDAC) 10 suppresses cervical cancer metastasis through inhibition of matrix metalloproteinase (MMP) 2 and 9 expression.
Song C, Zhu S, Wu C, Kang J
The Journal of biological chemistry 2013 Sep 27;288(39):28021-33
The Journal of biological chemistry 2013 Sep 27;288(39):28021-33
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-MMP9 antibody. Corresponding MMP9 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows strong positivity in the red pulp.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN