Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001814 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001814, RRID:AB_1080134
- Product name
- Anti-SOD2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEP
HINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAK
GDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGG
GEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGS
GWGWL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A fourteen gene GBM prognostic signature identifies association of immune response pathway and mesenchymal subtype with high risk group.
Hypothalamic mitochondrial dysfunction associated with anorexia in the anx/anx mouse
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Arimappamagan A, Somasundaram K, Thennarasu K, Peddagangannagari S, Srinivasan H, Shailaja BC, Samuel C, Patric IR, Shukla S, Thota B, Prasanna KV, Pandey P, Balasubramaniam A, Santosh V, Chandramouli BA, Hegde AS, Kondaiah P, Sathyanarayana Rao MR
PloS one 2013;8(4):e62042
PloS one 2013;8(4):e62042
Hypothalamic mitochondrial dysfunction associated with anorexia in the anx/anx mouse
Lindfors C, Nilsson I, Garcia-Roves P, Zuberi A, Karimi M, Donahue L, Roopenian D, Mulder J, Uhlen M, Ekstrom T, Davisson M, Hokfelt T, Schalling M, Johansen J
Proceedings of the National Academy of Sciences 2011 November;108(44):18108-18113
Proceedings of the National Academy of Sciences 2011 November;108(44):18108-18113
Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN