HPA035363

antibody from Atlas Antibodies

Targeting: CCDC39 CFAP59, CILD14, DKFZp434A128, FAP59

Antibody data

Submit

Validation data

Product number: HPA035363 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035363, RRID:AB_2674588
Product name: Anti-CCDC39
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TESEEHFKAIAQRELGRVKDEIQRLENEMASILEK KSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEE SAHKDSDALTLQKYAQQDDNKIRAL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CCDC39 protein structure - HPA035363 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bronchus, fallopian tube, rectum and tonsil using Anti-CCDC39 antibody HPA035363 (A) shows similar protein distribution across tissues to independent antibody HPA035364 (B).
Antibody #2 product nr: HPA035364
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bronchus shows moderate positivity in cilia of respiratory epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bronchus shows moderate positivity in cilia in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Sample type: HUMAN