HPA005550

antibody from Atlas Antibodies

Targeting: PROC

Antibody data

Submit

Validation data

Product number: HPA005550 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA005550, RRID:AB_1079687
Product name: Anti-PROC
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVF VHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLP DSGLAERELNQAGQETLVTGWGYHSSREKEAKRNR TFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PROC protein structure - HPA005550 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows extracellular immunoreactivity in blood vessel.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows positivity in plasma.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma in blood vessels.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate positivity in plasma in blood vessels.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes and strong positivity in plasma.
Sample type: HUMAN