HPA017931

antibody from Atlas Antibodies

Targeting: AAK1 DKFZp686K16132, KIAA1048

Antibody data

Submit

Validation data

Product number: HPA017931 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017931, RRID:AB_1844406
Product name: Anti-AAK1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGD AFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFG STSDAVIGKVIISVSSVMHDMCA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AAK1 protein structure - HPA017931 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human parathyroid gland and pancreas tissues using Anti-AAK1 antibody. Corresponding AAK1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and parathyroid gland using Anti-AAK1 antibody HPA017931 (A) shows similar protein distribution across tissues to independent antibody HPA020289 (B).
Antibody #2 product nr: HPA020289
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows strong membranous and cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human parathyroid gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-AAK1 antibody HPA017931.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-AAK1 antibody HPA017931.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-AAK1 antibody HPA017931.
Sample type: HUMAN