Antibody data

Product number
ABIN405154
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 141 (ZNF141) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405154
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF141 antibody: synthetic peptide directed towards the middle region of human ZNF141
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDK
AFKRF SHLNKHKKIH
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -