Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405154 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 141 (ZNF141) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF141 antibody: synthetic peptide directed towards the middle region of human ZNF141
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDK
AFKRF SHLNKHKKIH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references hZAC encodes a zinc finger protein with antiproliferative properties and maps to a chromosomal region frequently lost in cancer.
Varrault A, Ciani E, Apiou F, Bilanges B, Hoffmann A, Pantaloni C, Bockaert J, Spengler D, Journot L
Proceedings of the National Academy of Sciences of the United States of America 1998 Jul 21;95(15):8835-40
Proceedings of the National Academy of Sciences of the United States of America 1998 Jul 21;95(15):8835-40
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting