Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183807 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PR Domain Containing 13 (PRDM13) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRDM13 antibody: synthetic peptide directed towards the C terminal of human PRDM13
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFT
DDQSD PEVGGGGERD- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.
Behrends U, Schneider I, Rössler S, Frauenknecht H, Golbeck A, Lechner B, Eigenstetter G, Zobywalski C, Müller-Weihrich S, Graubner U, Schmid I, Sackerer D, Späth M, Goetz C, Prantl F, Asmuss HP, Bise K, Mautner J
International journal of cancer. Journal international du cancer 2003 Aug 20;106(2):244-51
International journal of cancer. Journal international du cancer 2003 Aug 20;106(2):244-51
No comments: Submit comment
No validations: Submit validation data