Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183943 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the N terminal of human HNRPA1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFE
QWGTL TDCVVMRDPN- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Aptamer BC15 against heterogeneous nuclear ribonucleoprotein A1 has potential value in diagnosis and therapy of hepatocarcinoma.
The obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1.
Identification of an aptamer targeting hnRNP A1 by tissue slide-based SELEX.
Regulation of gamma-fibrinogen chain expression by heterogeneous nuclear ribonucleoprotein A1.
Li S, Wang W, Ding H, Xu H, Zhao Q, Li J, Li H, Xia W, Su X, Chen Y, Fang T, Shao N, Zhang H
Nucleic acid therapeutics 2012 Dec;22(6):391-8
Nucleic acid therapeutics 2012 Dec;22(6):391-8
The obligatory intestinal folate transporter PCFT (SLC46A1) is regulated by nuclear respiratory factor 1.
Gonen N, Assaraf YG
The Journal of biological chemistry 2010 Oct 29;285(44):33602-13
The Journal of biological chemistry 2010 Oct 29;285(44):33602-13
Identification of an aptamer targeting hnRNP A1 by tissue slide-based SELEX.
Li S, Xu H, Ding H, Huang Y, Cao X, Yang G, Li J, Xie Z, Meng Y, Li X, Zhao Q, Shen B, Shao N
The Journal of pathology 2009 Jul;218(3):327-36
The Journal of pathology 2009 Jul;218(3):327-36
Regulation of gamma-fibrinogen chain expression by heterogeneous nuclear ribonucleoprotein A1.
Xia H
The Journal of biological chemistry 2005 Apr 1;280(13):13171-8
The Journal of biological chemistry 2005 Apr 1;280(13):13171-8
No comments: Submit comment
No validations: Submit validation data