H00028511-M02
antibody from Abnova Corporation
Targeting: NKIRAS2
DKFZP434N1526, kappaB-Ras2, KBRAS2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028511-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028511-M02, RRID:AB_530147
- Product name
- NKIRAS2 monoclonal antibody (M02), clone 2G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NKIRAS2.
- Antigen sequence
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEM
IETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE
LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEID
KSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK
SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKS
AFPLSRKNKGSGSLDG- Isotype
- IgG
- Antibody clone number
- 2G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Estradiol suppresses NF-kappa B activation through coordinated regulation of let-7a and miR-125b in primary human macrophages.
Murphy AJ, Guyre PM, Pioli PA
Journal of immunology (Baltimore, Md. : 1950) 2010 May 1;184(9):5029-37
Journal of immunology (Baltimore, Md. : 1950) 2010 May 1;184(9):5029-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NKIRAS2 monoclonal antibody (M02), clone 2G9 Western Blot analysis of NKIRAS2 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NKIRAS2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NKIRAS2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol