HPA005785
antibody from Atlas Antibodies
Targeting: CD44
CD44R, CSPG8, HCELL, IN, MC56, MDU2, MDU3, MIC4, Pgp1
Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005785 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005785, RRID:AB_1078467
- Product name
- Anti-CD44
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP
WITDSTDRIPATTLMSTSATATETATKRQETWDWF
SWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE
ENEDERDRHLSFSGSGIDDDEDFISSTISTTPR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references EpCAM-Independent Enrichment of Circulating Tumor Cells in Metastatic Breast Cancer.
Superficial scrapings from breast tumors is a source for biobanking and research purposes
Optimization of tumor xenograft dissociation for the profiling of cell surface markers and nutrient transporters
Identification of a population of blood circulating tumor cells from breast cancer patients that initiates metastasis in a xenograft assay
Metformin regulates breast cancer stem cell ontogeny by transcriptional regulation of the epithelial-mesenchymal transition (EMT) status.
Synthesis of hyaluronan in oesophageal cancer cells is uncoupled from the prostaglandin-cAMP pathway.
Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
Schneck H, Gierke B, Uppenkamp F, Behrens B, Niederacher D, Stoecklein NH, Templin MF, Pawlak M, Fehm T, Neubauer H, Disseminated Cancer Cell Network (DCC Net) Duesseldorf
PloS one 2015;10(12):e0144535
PloS one 2015;10(12):e0144535
Superficial scrapings from breast tumors is a source for biobanking and research purposes
Ma R, Fredriksson I, Karthik G, Winn G, Darai-Ramqvist E, Bergh J, Hartman J
Laboratory Investigation 2014 April;94(7):796-805
Laboratory Investigation 2014 April;94(7):796-805
Optimization of tumor xenograft dissociation for the profiling of cell surface markers and nutrient transporters
Petit V, Massonnet G, Maciorowski Z, Touhami J, Thuleau A, Némati F, Laval J, Château-Joubert S, Servely J, Vallerand D, Fontaine J, Taylor N, Battini J, Sitbon M, Decaudin D
Laboratory Investigation 2013 March;93(5):611-621
Laboratory Investigation 2013 March;93(5):611-621
Identification of a population of blood circulating tumor cells from breast cancer patients that initiates metastasis in a xenograft assay
Baccelli I, Schneeweiss A, Riethdorf S, Stenzinger A, Schillert A, Vogel V, Klein C, Saini M, Bäuerle T, Wallwiener M, Holland-Letz T, Höfner T, Sprick M, Scharpff M, Marmé F, Sinn H, Pantel K, Weichert W, Trumpp A
Nature Biotechnology 2013 April;31(6):539-544
Nature Biotechnology 2013 April;31(6):539-544
Metformin regulates breast cancer stem cell ontogeny by transcriptional regulation of the epithelial-mesenchymal transition (EMT) status.
Vazquez-Martin A, Oliveras-Ferraros C, Cufí S, Del Barco S, Martin-Castillo B, Menendez JA
Cell cycle (Georgetown, Tex.) 2010 Sep 15;9(18):3807-14
Cell cycle (Georgetown, Tex.) 2010 Sep 15;9(18):3807-14
Synthesis of hyaluronan in oesophageal cancer cells is uncoupled from the prostaglandin-cAMP pathway.
Twarock S, Röck K, Sarbia M, Weber AA, Jänicke RU, Fischer JW
British journal of pharmacology 2009 May;157(2):234-43
British journal of pharmacology 2009 May;157(2):234-43
Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma
Asplund A, Gry Björklund M, Sundquist C, Strömberg S, Edlund K, Östman A, Nilsson P, Pontén F, Lundeberg J
British Journal of Dermatology 2008 March;158(3):527-538
British Journal of Dermatology 2008 March;158(3):527-538
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U-251MG and MCF-7 using Anti-CD44 antibody. Corresponding CD44 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA005785 antibody. Corresponding CD44 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong membranous positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human squamous cell lung carcinoma shows strong membranous positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong positivity in plasma membrane in non-germinal center cells.
- Sample type
- HUMAN