Antibody data

Product number
H00006920-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006920-M06, RRID:AB_463902
Product name
TCEA3 monoclonal antibody (M06), clone 2C9
Provider product page
Abnova Corporation - H00006920-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TCEA3.
Antigen sequence
MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHS
CQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKV
LIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLEC
SDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSS
PKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMC
LLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGV
NCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNL
KDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDEL
RELRNAMTQEAIREHQMAKTGGTTTDLFQCSKCKK
KNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
Isotype
IgG
Antibody clone number
2C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.