HPA043200

ALMS1 antibody from Atlas Antibodies
KIAA0328
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043200
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043200, RRID:AB_10796689
Product name
Anti-ALMS1
Provider product page
Atlas Antibodies - HPA043200
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKS
LSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQR
DQKVTP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -