Antibody data

Product number
PAB24022
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB24022, RRID:AB_11121001
Product name
ALMS1 polyclonal antibody
Provider product page
Abnova Corporation - PAB24022
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ALMS1.
Antigen sequence
DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKS
LSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQR
DQKVTP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -