Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183564 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 192 (ZNF192) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the N terminal of human ZNF192
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
PSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPL
GQEVF RLRFRQLRYQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
Dias Neto E, Correa RG, Verjovski-Almeida S, Briones MR, Nagai MA, da Silva W Jr, Zago MA, Bordin S, Costa FF, Goldman GH, Carvalho AF, Matsukuma A, Baia GS, Simpson DH, Brunstein A, de Oliveira PS, Bucher P, Jongeneel CV, O'Hare MJ, Soares F, Brentani RR, Reis LF, de Souza SJ, Simpson AJ
Proceedings of the National Academy of Sciences of the United States of America 2000 Mar 28;97(7):3491-6
Proceedings of the National Academy of Sciences of the United States of America 2000 Mar 28;97(7):3491-6
No comments: Submit comment
No validations: Submit validation data