Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000183-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000183-M01, RRID:AB_463774
- Product name
- AGT monoclonal antibody (M01), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AGT.
- Antigen sequence
TIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELN
LQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQ
LNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A haplotype of human angiotensinogen gene containing -217A increases blood pressure in transgenic mice compared with -217G.
HNF-1alpha plays an important role in IL-6-induced expression of the human angiotensinogen gene.
Jain S, Vinukonda G, Fiering SN, Kumar A
American journal of physiology. Regulatory, integrative and comparative physiology 2008 Dec;295(6):R1849-57
American journal of physiology. Regulatory, integrative and comparative physiology 2008 Dec;295(6):R1849-57
HNF-1alpha plays an important role in IL-6-induced expression of the human angiotensinogen gene.
Jain S, Li Y, Patil S, Kumar A
American journal of physiology. Cell physiology 2007 Jul;293(1):C401-10
American journal of physiology. Cell physiology 2007 Jul;293(1):C401-10
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AGT monoclonal antibody (M01), clone 1A10 Western Blot analysis of AGT expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AGT expression in transfected 293T cell line by AGT monoclonal antibody (M01), clone 1A10.Lane 1: AGT transfected lysate(53 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AGT is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
