HPA005692

antibody from Atlas Antibodies

Targeting: TF PRO1557, PRO2086

Antibody data

Submit

Validation data

Product number: HPA005692 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA005692, RRID:AB_1080354
Product name: Anti-TF
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRN LREGTCPEAPTDECKPVKWCALSHHERLKCDEWSV NSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGF VYIAGKCGLVPVLAENYNKSDNCEDTPEAG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TF protein structure - HPA005692 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA005692 antibody. Corresponding TF RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and ovary using Anti-TF antibody HPA005692 (A) shows similar protein distribution across tissues to independent antibody HPA001527 (B).
Antibody #2 product nr: HPA001527
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human plasma shows moderate positivity.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-TF antibody HPA005692.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-TF antibody HPA005692.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human ovary using Anti-TF antibody HPA005692.
Sample type: HUMAN