Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010577-M11 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010577-M11, RRID:AB_1678970
- Product name
- NPC2 monoclonal antibody (M11), clone 1F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NPC2.
- Antigen sequence
GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFP
IPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPS
IKLVVEWQLQDDKNQSLFCWEIPVQIVSHL- Isotype
- IgG
- Antibody clone number
- 1F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NPC2 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of NPC2 transfected lysate using anti-NPC2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NPC2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol