Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001612 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001612, RRID:AB_1078825
- Product name
- Anti-FBLN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQ
DALGNCIDINECLSISAPCPIGHTCINTEGSYTCQ
KNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKG
HRCVNSPGSFRCECKTGYYFDGISRMCVDVNE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Plasma Profiling Reveals Human Fibulin-1 as Candidate Marker for Renal Impairment
Identification of a progenitor cell of origin capable of generating diverse meningioma histological subtypes
Neiman M, Hedberg J, Dönnes P, Schuppe-Koistinen I, Hanschke S, Schindler R, Uhlén M, Schwenk J, Nilsson P
Journal of Proteome Research 2011 November;10(11):4925-4934
Journal of Proteome Research 2011 November;10(11):4925-4934
Identification of a progenitor cell of origin capable of generating diverse meningioma histological subtypes
Kalamarides M, Stemmer-Rachamimov A, Niwa-Kawakita M, Chareyre F, Taranchon E, Han Z, Martinelli C, Lusis E, Hegedus B, Gutmann D, Giovannini M
Oncogene 2011 January;30(20):2333-2344
Oncogene 2011 January;30(20):2333-2344
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and FBLN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416606).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human plasma.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cervix, uterine and liver tissues using Anti-FBLN1 antibody. Corresponding FBLN1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN