Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002118-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002118-M01, RRID:AB_425421
- Product name
- ETV4 monoclonal antibody (M01), clone 3G9-1B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ETV4.
- Antigen sequence
MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCV
APEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFL
VALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWG
IQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYV
YKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEED
TVPLSHLDESPAYLPELAGPAQPFGPKGGYSY- Isotype
- IgG
- Antibody clone number
- 3G9-1B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A fluorescence in situ hybridization screen for E26 transformation-specific aberrations: identification of DDX5-ETV4 fusion protein in prostate cancer.
Han B, Mehra R, Dhanasekaran SM, Yu J, Menon A, Lonigro RJ, Wang X, Gong Y, Wang L, Shankar S, Laxman B, Shah RB, Varambally S, Palanisamy N, Tomlins SA, Kumar-Sinha C, Chinnaiyan AM
Cancer research 2008 Sep 15;68(18):7629-37
Cancer research 2008 Sep 15;68(18):7629-37
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ETV4 expression in transfected 293T cell line by ETV4 monoclonal antibody (M01), clone 3G9-1B9.Lane 1: ETV4 transfected lysate(54 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ETV4 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol