Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007023-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007023-M01, RRID:AB_714881
- Product name
- TFAP4 monoclonal antibody (M01), clone 6B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TFAP4.
- Antigen sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKR
RRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQL
DKERSVRMMLEEQVRSLEAHMYPEKLKVIA- Isotype
- IgG
- Antibody clone number
- 6B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ectopic AP4 expression induces cellular senescence via activation of p53 in long-term confluent retinal pigment epithelial cells.
Wang Y, Wong MM, Zhang X, Chiu SK
Experimental cell research 2015 Nov 15;339(1):135-46
Experimental cell research 2015 Nov 15;339(1):135-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol