Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004780-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004780-M03, RRID:AB_581870
- Product name
- NFE2L2 monoclonal antibody (M03), clone 1B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NFE2L2.
- Antigen sequence
FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQV
AHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATF
QSLVPDIPGHIESPVFIATNQAQSPETSVA- Isotype
- IgG
- Antibody clone number
- 1B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Examining the endogenous antioxidant response through immunofluorescent analysis of Nrf2 in tissue.
Lindl KA, Jordan-Sciutto KL
Methods in molecular biology (Clifton, N.J.) 2008;477:229-43
Methods in molecular biology (Clifton, N.J.) 2008;477:229-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NFE2L2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NFE2L2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol