Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310615 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane 9 Superfamily Member 1 (TM9SF1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TM9SF1 antibody: synthetic peptide directed towards the N terminal of human TM9SF1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLP
VCCPE KIRHKSLSLG- Vial size
- 0.1 mg
Submitted references High-throughput functional screening for autophagy-related genes and identification of TM9SF1 as an autophagosome-inducing gene.
The iodocyanopindolol and SM-11044 binding protein belongs to the TM9SF multispanning membrane protein superfamily.
He P, Peng Z, Luo Y, Wang L, Yu P, Deng W, An Y, Shi T, Ma D
Autophagy 2009 Jan;5(1):52-60
Autophagy 2009 Jan;5(1):52-60
The iodocyanopindolol and SM-11044 binding protein belongs to the TM9SF multispanning membrane protein superfamily.
Sugasawa T, Lenzen G, Simon S, Hidaka J, Cahen A, Guillaume JL, Camoin L, Strosberg AD, Nahmias C
Gene 2001 Aug 8;273(2):227-37
Gene 2001 Aug 8;273(2):227-37
No comments: Submit comment
No validations: Submit validation data